ID3 (NM_002167) Human Recombinant Protein
CAT#: TP300583M
Recombinant protein of human inhibitor of DNA binding 3, dominant negative helix-loop-helix protein (ID3), 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200583 protein sequence
Red=Cloning site Green=Tags(s) MKALSPVRGCYEAVCCLSERSLAIARGRGKGPAAEEPLSLLDDMNHCYSRLRELVPGVPRGTQLSQVEIL QRVIDYILDLQVVLAEPAPGPPDGPHLPIQTAELAPELVISNDKRSFCH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 12.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002158 |
| Locus ID | 3399 |
| UniProt ID | Q02535 |
| Refseq Size | 1252 |
| Cytogenetics | 1p36.12 |
| Refseq ORF | 357 |
| Synonyms | bHLHb25; HEIR-1 |
| Summary | The protein encoded by this gene is a helix-loop-helix (HLH) protein that can form heterodimers with other HLH proteins. However, the encoded protein lacks a basic DNA-binding domain and therefore inhibits the DNA binding of any HLH protein with which it interacts. [provided by RefSeq, Aug 2011] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors |
| Protein Pathways | TGF-beta signaling pathway |
Documents
| FAQs |
| SDS |


