PRKRA (NM_003690) Human Recombinant Protein
CAT#: TP300578
Recombinant protein of human protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1, 20 µg
View other "PRKRA" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200578 protein sequence
Red=Cloning site Green=Tags(s) MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRV TVGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGW RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENHISLTNVVGHS LGCTWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSP ITVCHGSGISCGNAQSDAAHNALQYLKIIAERK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003681 |
| Locus ID | 8575 |
| UniProt ID | O75569 |
| Refseq Size | 1826 |
| Cytogenetics | 2q31.2 |
| Refseq ORF | 939 |
| Synonyms | DYT16; HSD14; PACT; RAX |
| Summary | This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401219 | PRKRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427977 | PRKRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427978 | PRKRA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401219 | Transient overexpression lysate of protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 1 |
CNY 3080.00 |
|
| LY427977 | Transient overexpression lysate of protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 2 |
CNY 3080.00 |
|
| LY427978 | Transient overexpression lysate of protein kinase, interferon-inducible double stranded RNA dependent activator (PRKRA), transcript variant 3 |
CNY 3080.00 |
|
| PH300578 | PRKRA MS Standard C13 and N15-labeled recombinant protein (NP_003681) |
CNY 19520.00 |
