ARL2 (NM_001667) Human Recombinant Protein
CAT#: TP300501
Recombinant protein of human ADP-ribosylation factor-like 2 (ARL2), 20 µg
View other "ARL2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200501 protein sequence
Red=Cloning site Green=Tags(s) MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQ KSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIRE VLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001658 |
Locus ID | 402 |
UniProt ID | P36404 |
Refseq Size | 993 |
Cytogenetics | 11q13.1 |
Refseq ORF | 552 |
Synonyms | ARFL2 |
Summary | This gene encodes a small GTP-binding protein of the RAS superfamily which functions as an ADP-ribosylation factor (ARF). The encoded protein is one of a functionally distinct group of ARF-like genes. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419817 | ARL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419817 | Transient overexpression lysate of ADP-ribosylation factor-like 2 (ARL2) |
CNY 3080.00 |
|
PH300501 | ARL2 MS Standard C13 and N15-labeled recombinant protein (NP_001658) |
CNY 14250.00 |