Actin Regulatory Protein CAPG (CAPG) (NM_001747) Human Recombinant Protein
CAT#: TP300497
Recombinant protein of human capping protein (actin filament), gelsolin-like (CAPG), 20 µg
View other "Actin Regulatory Protein CAPG" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200497 protein sequence
Red=Cloning site Green=Tags(s) MYTAIPQSGSPFPGSVQDPGLHVWRVEKLKPVPVAQENQGVFFSGDSYLVLHNGPEEVSHLHLWIGQQSS RDEQGACAVLAVHLNTLLGERPVQHREVQGNESDLFMSYFPRGLKYQEGGVESAFHKTSTGAPAAIKKLY QVKGKKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGGKSNILERNKARDLALAIRDSERQGKAQVEI VTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKANAQAAALYKVSDATGQMNLTKVADSSPFALELLISD DCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEGFISRMQYAPNTQVEILPQGRESPIFKQFFKDWK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 38.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001738 |
| Locus ID | 822 |
| UniProt ID | P40121 |
| Refseq Size | 1604 |
| Cytogenetics | 2p11.2 |
| Refseq ORF | 1044 |
| Synonyms | AFCP; HEL-S-66; MCP |
| Summary | This gene encodes a member of the gelsolin/villin family of actin-regulatory proteins. The encoded protein reversibly blocks the barbed ends of F-actin filaments in a Ca2+ and phosphoinositide-regulated manner, but does not sever preformed actin filaments. By capping the barbed ends of actin filaments, the encoded protein contributes to the control of actin-based motility in non-muscle cells. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jan 2012] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419770 | CAPG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419770 | Transient overexpression lysate of capping protein (actin filament), gelsolin-like (CAPG) |
CNY 3080.00 |
|
| PH300497 | CAPG MS Standard C13 and N15-labeled recombinant protein (NP_001738) |
CNY 19520.00 |
其它Actin Regulatory Protein CAPG产品
