CNTF Receptor alpha (CNTFR) (NM_147164) Human Recombinant Protein
CAT#: TP300487
Recombinant protein of human ciliary neurotrophic factor receptor (CNTFR), transcript variant 1, 20 µg
View other "CNTF Receptor alpha" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200487 protein sequence
Red=Cloning site Green=Tags(s) MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLN GSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNT FNVTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIVKPDPPENV VARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDGTAHTITDAYAGKEYIIQV AAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTSTTSSLAPPPTTKICDPGELGSGGGPSAPF LVSVPITLALAAAAATASSLLI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 38.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_671693 |
| Locus ID | 1271 |
| UniProt ID | P26992 |
| Refseq Size | 2070 |
| Cytogenetics | 9p13.3 |
| Refseq ORF | 1116 |
| Summary | This gene encodes a member of the type 1 cytokine receptor family. The encoded protein is the ligand-specific component of a tripartite receptor for ciliary neurotrophic factor, which plays a critical role in neuronal cell survival, differentiation and gene expression. Binding of ciliary neurotrophic factor to the encoded protein recruits the transmembrane components of the receptor, gp130 and leukemia inhibitory factor receptor, facilitating signal transduction. Single nucleotide polymorphisms in this gene may be associated with variations in muscle strength, as well as early onset of eating disorders. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, May 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403449 | CNTFR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419721 | CNTFR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403449 | Transient overexpression lysate of ciliary neurotrophic factor receptor (CNTFR), transcript variant 1 |
CNY 3080.00 |
|
| LY419721 | Transient overexpression lysate of ciliary neurotrophic factor receptor (CNTFR), transcript variant 2 |
CNY 3080.00 |
|
| PH300487 | CNTFR MS Standard C13 and N15-labeled recombinant protein (NP_671693) |
CNY 19520.00 |
其它CNTF Receptor alpha产品
