PTP4A1 (NM_003463) Human Recombinant Protein
CAT#: TP300435L
Recombinant protein of human protein tyrosine phosphatase type IVA, member 1 (PTP4A1), 1 mg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 36000.00
货期*
4周
规格
推荐一起购买 (3)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200435 protein sequence
Red=Cloning site Green=Tags(s) MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPF DDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGA FNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 19.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003454 |
| Locus ID | 7803 |
| UniProt ID | Q93096 |
| Refseq Size | 5093 |
| Cytogenetics | 6q12 |
| Refseq ORF | 519 |
| Synonyms | HH72; PRL-1; PRL1; PTP(CAAX1); PTPCAAX1 |
| Summary | This gene encodes a member of a small class of prenylated protein tyrosine phosphatases (PTPs), which contain a PTP domain and a characteristic C-terminal prenylation motif. The encoded protein is a cell signaling molecule that plays regulatory roles in a variety of cellular processes, including cell proliferation and migration. The protein may also be involved in cancer development and metastasis. This tyrosine phosphatase is a nuclear protein, but may associate with plasma membrane by means of its prenylation motif. Pseudogenes related to this gene are located on chromosomes 1, 2, 5, 7, 11 and X. [provided by RefSeq, Jun 2013] |
| Protein Families | Druggable Genome, Phosphatase |
Documents
| FAQs |
| SDS |
You may also need
Customer
Reviews
Loading...
