SATB1 (NM_002971) Human Recombinant Protein
CAT#: TP300421
Recombinant protein of human SATB homeobox 1 (SATB1), transcript variant 1, 20 µg
View other "SATB1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200421 protein sequence
Red=Cloning site Green=Tags(s) MDHLNEATQGKEHSEMSNNVSDPKGPPAKIARLEQNGSPLGRGRLGSTGAKMQGVPLKHSGHLMKTNLRK GTMLPVFCVVEHYENAIEYDCKEEHAEFVLVRKDMLFNQLIEMALLSLGYSHSSAAQAKGLIQVGKWNPV PLSYVTDAPDATVADMLQDVYHVVTLKIQLHSCPKLEDLPPEQWSHTTVRNALKDLLKDMNQSSLAKECP LSQSMISSIVNSTYYANVSAAKCQEFGRWYKHFKKTKDMMVEMDSLSELSQQGANHVNFGQQPVPGNTAE QPPSPAQLSHGSQPSVRTPLPNLHPGLVSTPISPQLVNQQLVMAQLLNQQYAVNRLLAQQSLNQQYLNHP PPVSRSMNKPLEQQVSTNTEVSSEIYQWVRDELKRAGISQAVFARVAFNRTQGLLSEILRKEEDPKTASQ SLLVNLRAMQNFLQLPEAERDRIYQDERERSLNAASAMGPAPLISTPPSRPPQVKTATIATERNGKPENN TMNINASIYDEIQQEMKRAKVSQALFAKVAATKSQGWLCELLRWKEDPSPENRTLWENLSMIRRFLSLPQ PERDAIYEQESNAVHHHGDRPPHIIHVPAEQIQQQQQQQQQQQQQQQAPPPPQPQQQPQTGPRLPPRQPT VASPAESDEENRQKTRPRTKISVEALGILQSFIQDVGLYPDEEAIQTLSAQLDLPKYTIIKFFQNQRYYL KHHGKLKDNSGLEVDVAEYKEEELLKDLEESVQDKNTNTLFSVKLEEELSVEGNTDINTDLKD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 85.8 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002962 |
| Locus ID | 6304 |
| UniProt ID | Q01826 |
| Refseq Size | 5556 |
| Cytogenetics | 3p24.3 |
| Refseq ORF | 2289 |
| Synonyms | DEFDA; KTZSL |
| Summary | This gene encodes a matrix protein which binds nuclear matrix and scaffold-associating DNAs through a unique nuclear architecture. The protein recruits chromatin-remodeling factors in order to regulate chromatin structure and gene expression. [provided by RefSeq, Apr 2016] |
| Protein Families | Druggable Genome, Transcription Factors |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Molecular correlates and prognostic significance of SATB1 expression in colorectal cancer
,null,
Diagnostic Pathology
,PubMed ID 22935204
[SATB1]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418976 | SATB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427355 | SATB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY418976 | Transient overexpression lysate of SATB homeobox 1 (SATB1), transcript variant 1 |
CNY 3080.00 |
|
| LY427355 | Transient overexpression lysate of SATB homeobox 1 (SATB1), transcript variant 2 |
CNY 4840.00 |
|
| PH300421 | SATB1 MS Standard C13 and N15-labeled recombinant protein (NP_002962) |
CNY 19520.00 |
|
| PH326152 | SATB1 MS Standard C13 and N15-labeled recombinant protein (NP_001124482) |
CNY 19520.00 |
|
| TP326152 | Recombinant protein of human SATB homeobox 1 (SATB1), transcript variant 2, 20 µg |
CNY 2900.00 |


