EIPR1 (NM_003310) Human Recombinant Protein
CAT#: TP300409
Recombinant protein of human tumor suppressing subtransferable candidate 1 (TSSC1), 20 µg
View other "EIPR1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200409 protein sequence
Red=Cloning site Green=Tags(s) MEDDAPVIYGLEFQARALTPQTAETDAIRFLVGTQSLKYDNQIHIIDFDDENNIINKNVLLHQAGEIWHI SASPADRGVLTTCYNRTSDSKVLTCAAVWRMPKELESGSHESPDDSSSTAQTLELLCHLDNTAHGNMACV VWEPMGDGKKIISLADNHILLWDLQESSSQAVLASSASLEGKGQLKFTSGRWSPHHNCTQVATANDTTLR GWDTRSMSQIYCIENAHGQLVRDLDFNPNKQYYLASCGDDCKVKFWDTRNVTEPVKTLEEHSHWVWNVRY NHSHDQLVLTGSSDSRVILSNMVSISSEPFGHLVDDDDISDQEDHRSEEKSKEPLQDNVIATYEEHEDSV YAVDWSSADPWLFASLSYDGRLVINRVPRALKYHILL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003301 |
Locus ID | 7260 |
UniProt ID | Q53HC9 |
Refseq Size | 1732 |
Cytogenetics | 2p25.3 |
Refseq ORF | 1161 |
Synonyms | EIPR-1; TSSC1 |
Summary | This gene has been reported in PMID 9403053 as one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alignment of this gene to genomic sequence data suggests that this gene resides on chromosome 2 rather than chromosome 11. [provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418772 | TSSC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418772 | Transient overexpression lysate of tumor suppressing subtransferable candidate 1 (TSSC1) |
CNY 3080.00 |
|
PH300409 | TSSC1 MS Standard C13 and N15-labeled recombinant protein (NP_003301) |
CNY 19520.00 |