EIPR1 (NM_003310) Human Recombinant Protein
CAT#: TP300409
Recombinant protein of human tumor suppressing subtransferable candidate 1 (TSSC1), 20 µg
View other "EIPR1" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC200409 protein sequence 
Red=Cloning site Green=Tags(s) MEDDAPVIYGLEFQARALTPQTAETDAIRFLVGTQSLKYDNQIHIIDFDDENNIINKNVLLHQAGEIWHI SASPADRGVLTTCYNRTSDSKVLTCAAVWRMPKELESGSHESPDDSSSTAQTLELLCHLDNTAHGNMACV VWEPMGDGKKIISLADNHILLWDLQESSSQAVLASSASLEGKGQLKFTSGRWSPHHNCTQVATANDTTLR GWDTRSMSQIYCIENAHGQLVRDLDFNPNKQYYLASCGDDCKVKFWDTRNVTEPVKTLEEHSHWVWNVRY NHSHDQLVLTGSSDSRVILSNMVSISSEPFGHLVDDDDISDQEDHRSEEKSKEPLQDNVIATYEEHEDSV YAVDWSSADPWLFASLSYDGRLVINRVPRALKYHILL myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 43.4 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_003301 | 
| Locus ID | 7260 | 
| UniProt ID | Q53HC9 | 
| Refseq Size | 1732 | 
| Cytogenetics | 2p25.3 | 
| Refseq ORF | 1161 | 
| Synonyms | EIPR-1; TSSC1 | 
| Summary | This gene has been reported in PMID 9403053 as one of several tumor-suppressing subtransferable fragments located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alignment of this gene to genomic sequence data suggests that this gene resides on chromosome 2 rather than chromosome 11. [provided by RefSeq, Dec 2008] | 
| Protein Families | Druggable Genome | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC418772 | TSSC1 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY418772 | Transient overexpression lysate of tumor suppressing subtransferable candidate 1 (TSSC1) | 
                                                     CNY 3080.00  | 
                                            |
| PH300409 | TSSC1 MS Standard C13 and N15-labeled recombinant protein (NP_003301) | 
                                                     CNY 19520.00  | 
                                            
