FHL2 (NM_201557) Human Recombinant Protein
CAT#: TP300398
Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 4, 20 µg
View other "FHL2" proteins (16)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200398 protein sequence
Red=Cloning site Green=Tags(s) MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRHWHEACFHCSQ CRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGSSWHETCFICHRCQQPIGTKS FIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQPWHKECFVCTACRKQLSGQRFTARDDFAYCL NCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_963851 |
| Locus ID | 2274 |
| UniProt ID | Q14192 |
| Refseq Size | 1727 |
| Cytogenetics | 2q12.2 |
| Refseq ORF | 837 |
| Synonyms | AAG11; DRAL; FHL-2; SLIM-3; SLIM3 |
| Summary | This gene encodes a member of the four-and-a-half-LIM-only protein family. Family members contain two highly conserved, tandemly arranged, zinc finger domains with four highly conserved cysteines binding a zinc atom in each zinc finger. This protein is thought to have a role in the assembly of extracellular membranes. Also, this gene is down-regulated during transformation of normal myoblasts to rhabdomyosarcoma cells and the encoded protein may function as a link between presenilin-2 and an intracellular signaling pathway. Multiple alternatively spliced variants encoding different isoforms have been identified. [provided by RefSeq, Jan 2016] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404459 | FHL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404460 | FHL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419930 | FHL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422060 | FHL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404459 | Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 2 |
CNY 3080.00 |
|
| LY404460 | Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 4 |
CNY 3080.00 |
|
| LY419930 | Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 1 |
CNY 3080.00 |
|
| LY422060 | Transient overexpression lysate of four and a half LIM domains 2 (FHL2), transcript variant 5 |
CNY 3080.00 |
|
| PH300398 | FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_963851) |
CNY 14250.00 |
|
| PH319762 | FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_001034581) |
CNY 14250.00 |
|
| PH320344 | FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_001441) |
CNY 14250.00 |
|
| PH320395 | FHL2 MS Standard C13 and N15-labeled recombinant protein (NP_963849) |
CNY 19520.00 |
|
| TP319762 | Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 5, 20 µg |
CNY 2900.00 |
|
| TP320344 | Purified recombinant protein of Homo sapiens four and a half LIM domains 2 (FHL2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP320395 | Recombinant protein of human four and a half LIM domains 2 (FHL2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP760738 | Purified recombinant protein of Human four and a half LIM domains 2 (FHL2), transcript variant 5, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
