Aldolase C (ALDOC) (NM_005165) Human Recombinant Protein
CAT#: TP300333
Recombinant protein of human aldolase C, fructose-bisphosphate (ALDOC), 20 µg
View other "Aldolase C" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200333 protein sequence
Red=Cloning site Green=Tags(s) MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRV KKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKK DGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL AAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEA SFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDG GAAAQSLYIANHAY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005156 |
| Locus ID | 230 |
| UniProt ID | P09972 |
| Refseq Size | 1665 |
| Cytogenetics | 17q11.2 |
| Refseq ORF | 1092 |
| Synonyms | ALDC |
| Summary | This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417475 | ALDOC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417475 | Transient overexpression lysate of aldolase C, fructose-bisphosphate (ALDOC) |
CNY 3080.00 |
|
| PH300333 | ALDOC MS Standard C13 and N15-labeled recombinant protein (NP_005156) |
CNY 19520.00 |
|
| TP721085 | Purified recombinant protein of Human aldolase C, fructose-bisphosphate (ALDOC) |
CNY 1800.00 |
其它Aldolase C产品
