PSME3 (NM_005789) Human Recombinant Protein
CAT#: TP300308L
Recombinant protein of human proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 1, 1 mg
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 36000.00
货期*
                        4周
                    规格
                        
                         推荐一起购买 (2)
                    
                    
                                        DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
                                    
                                CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC200308 protein sequence 
Red=Cloning site Green=Tags(s) MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHSDMNLPVPDPI LLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLLIEKCNTVKMWV QLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEID EKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 29.3 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_005780 | 
| Locus ID | 10197 | 
| UniProt ID | P61289 | 
| Refseq Size | 3455 | 
| Cytogenetics | 17q21.31 | 
| Refseq ORF | 762 | 
| Synonyms | HEL-S-283; Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA | 
| Summary | The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2012] | 
| Protein Families | Stem cell - Pluripotency | 
| Protein Pathways | Antigen processing and presentation, Proteasome | 
Documents
| FAQs | 
| SDS | 
            You may also need
        
        
    
                         Customer
                                Reviews 
                    
                    
                                Loading...
                            
                        