B4GALT7 (NM_007255) Human Recombinant Protein
CAT#: TP300258
Recombinant protein of human xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 (galactosyltransferase I) (B4GALT7), 20 µg
View other "B4GALT7" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200258 protein sequence
Red=Cloning site Green=Tags(s) MFPSRRKAAQLPWEDGRSGLLSGGLPRKCSVFHLFVACLSLGFFSLLWLQLSCSGDVARAVRGQGQETSG PPRACPPEPPPEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFN RAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVGGILLLSKQH YRLCNGMSNRFWGWGREDDEFYRRIKGAGLQLFRPSGITTGYKTFRHLHDPAWRKRDQKRIAAQKQEQFK VDREGGLNTVKYHVASRTALSVGGAPCTVLNIMLDCDKTATPWCTFS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009186 |
Locus ID | 11285 |
UniProt ID | Q9UBV7 |
Refseq Size | 1747 |
Cytogenetics | 5q35.3 |
Refseq ORF | 981 |
Synonyms | EDSP1; EDSSLA; EDSSPD1; XGALT1; XGPT; XGPT1 |
Summary | This gene is a member of the beta-1,4-galactosyltransferase (beta4GalT) family. Family members encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose. Each beta4GalT member has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus which then remains uncleaved to function as a transmembrane anchor. The enzyme encoded by this gene attaches the first galactose in the common carbohydrate-protein linkage (GlcA-beta1,3-Gal-beta1,3-Gal-beta1,4-Xyl-beta1-O-Ser) found in proteoglycans. This enzyme differs from other beta4GalTs because it lacks the conserved Cys residues found in beta4GalT1-beta4GalT6 and it is located in cis-Golgi instead of trans-Golgi. Mutations in this gene have been associated with the progeroid form of Ehlers-Danlos syndrome. [provided by RefSeq, Oct 2009] |
Protein Families | Transmembrane |
Protein Pathways | Chondroitin sulfate biosynthesis, Heparan sulfate biosynthesis, Metabolic pathways |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Expansion of B4GALT7 linkeropathy phenotype to include perinatal lethal skeletal dysplasia
,null,
European Journal of Human Genetics
,PubMed ID 31278392
[B4GALT7]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416094 | B4GALT7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416094 | Transient overexpression lysate of xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 (galactosyltransferase I) (B4GALT7) |
CNY 3080.00 |
|
PH300258 | B4GALT7 MS Standard C13 and N15-labeled recombinant protein (NP_009186) |
CNY 19520.00 |
其它B4GALT7产品