14-3-3 epsilon (YWHAE) (NM_006761) Human Recombinant Protein
CAT#: TP300245
Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide (YWHAE), transcript variant 1, 20 µg
View other "14-3-3 epsilon" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200245 protein sequence
Red=Cloning site Green=Tags(s) MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKE ENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVFYYKMKGDYHRYLAEFATGND RKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLS EESYKDSTLIMQLLRDNLTLWTSDMQGDGEEQNKEALQDVEDENQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | In vitro ubiquitination assay (regulator) (PMID: 28212375) Co-immunoprecipitation (PMID: 28212375) |
| Reference Data | |
| RefSeq | NP_006752 |
| Locus ID | 7531 |
| UniProt ID | P62258 |
| Refseq Size | 1827 |
| Cytogenetics | 17p13.3 |
| Refseq ORF | 765 |
| Synonyms | 14-3-3E; HEL2; KCIP-1; MDCR; MDS |
| Summary | This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 100% identical to the mouse ortholog. It interacts with CDC25 phosphatases, RAF1 and IRS1 proteins, suggesting its role in diverse biochemical activities related to signal transduction, such as cell division and regulation of insulin sensitivity. It has also been implicated in the pathogenesis of small cell lung cancer. Two transcript variants, one protein-coding and the other non-protein-coding, have been found for this gene. [provided by RefSeq, Aug 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cell cycle, Neurotrophin signaling pathway, Oocyte meiosis |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Epilepsy-associated gene Nedd4-2 mediates neuronal activity and seizure susceptibility through AMPA receptors
,Zhu, J;Lee, KY;Jewett, KA;Man, HY;Chung, HJ;Tsai, NP;,
PLoS Genet
,PubMed ID 28212375
[YWHAE]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402021 | YWHAE HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402021 | Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide (YWHAE), transcript variant 1 |
CNY 3080.00 |
|
| PH300245 | YWHAE MS Standard C13 and N15-labeled recombinant protein (NP_006752) |
CNY 19520.00 |
|
| TP720511 | Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide (YWHAE), transcript variant 1 |
CNY 1800.00 |
其它14-3-3 epsilon产品
