PDCD10 (NM_007217) Human Recombinant Protein
CAT#: TP300235
Recombinant protein of human programmed cell death 10 (PDCD10), transcript variant 1, 20 µg
View other "PDCD10" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200235 protein sequence
Red=Cloning site Green=Tags(s) MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKK SVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKE LLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKT VA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_009148 |
Locus ID | 11235 |
UniProt ID | Q9BUL8 |
Refseq Size | 1454 |
Cytogenetics | 3q26.1 |
Refseq ORF | 636 |
Synonyms | CCM3; TFAR15 |
Summary | This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407854 | PDCD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC407855 | PDCD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416120 | PDCD10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407854 | Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 2 |
CNY 3,080.00 |
|
LY407855 | Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 3 |
CNY 3,080.00 |
|
LY416120 | Transient overexpression lysate of programmed cell death 10 (PDCD10), transcript variant 1 |
CNY 3,080.00 |
|
PH300235 | PDCD10 MS Standard C13 and N15-labeled recombinant protein (NP_009148) |
CNY 19,520.00 |
|
TP720886 | Purified recombinant protein of Human programmed cell death 10 (PDCD10), transcript variant 1 |
CNY 5,460.00 |