ELP6 (NM_001031703) Human Recombinant Protein
CAT#: TP300177
Recombinant protein of human chromosome 3 open reading frame 75 (C3orf75), 20 µg
View other "ELP6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200177 protein sequence
Red=Cloning site Green=Tags(s) MFVELNNLLNTTPDRAEQGKLTLLCDAKTDGSFLVHHFLSFYLKANCKVCFVALIQSFSHYSIVGQKLGV SLTMARERGQLVFLEGLKSAVDVVFQAQKEPHPLQFLREANAGNLKPLFEFVREALKPVDSGEARWTYPV LLVDDLSVLLSLGMGAVAVLDFIHYCRATVCWELKGNMVVLVHDSGDAEDEENDILLNGLSHQSHLILRA EGLATGFCRDVHGQLRILWRRPSQPAVHRDQSFTYQYKIQDKSVSFFCQRNVSCCSVT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001026873 |
| Locus ID | 54859 |
| UniProt ID | Q0PNE2 |
| Refseq Size | 1374 |
| Cytogenetics | 3p21.31 |
| Refseq ORF | 804 |
| Synonyms | C3orf75; TMEM103 |
| Summary | Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4. Involved in cell migration.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422157 | ELP6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422157 | Transient overexpression lysate of chromosome 3 open reading frame 75 (C3orf75) |
CNY 3080.00 |
|
| PH300177 | C3orf75 MS Standard C13 and N15-labeled recombinant protein (NP_001026873) |
CNY 19520.00 |
