IMPA2 (NM_014214) Human Recombinant Protein
CAT#: TP300063
Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 2 (IMPA2), 20 µg
View other "IMPA2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200063 protein sequence
Red=Cloning site Green=Tags(s) MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELR ERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEER LYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLA LCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTI NYGRDDEK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 31.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_055029 |
| Locus ID | 3613 |
| UniProt ID | O14732 |
| Refseq Size | 1537 |
| Cytogenetics | 18p11.21 |
| Refseq ORF | 864 |
| Summary | This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disorder. [provided by RefSeq, Jan 2011] |
| Protein Pathways | Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415429 | IMPA2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415429 | Transient overexpression lysate of inositol(myo)-1(or 4)-monophosphatase 2 (IMPA2) |
CNY 3080.00 |
|
| PH300063 | IMPA2 MS Standard C13 and N15-labeled recombinant protein (NP_055029) |
CNY 19520.00 |
|
| TP720526 | Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 2 (IMPA2) |
CNY 1800.00 |
