DCXR (NM_016286) Human Recombinant Protein
CAT#: TP300023M
Recombinant protein of human dicarbonyl/L-xylulose reductase (DCXR), 100 µg
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 9998.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200023 protein sequence
Red=Cloning site Green=Tags(s) MELFLAGRRVLVTGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVRECPGIEPVCVDLGDWEATERA LGSVGPVDLLVNNAAVALLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSSQCSQ RAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFA EVEHVVNAILFLLSDRSGMTTGSTLPVEGGFWAC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 25.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_057370 |
| Locus ID | 51181 |
| UniProt ID | Q7Z4W1 |
| Refseq Size | 860 |
| Cytogenetics | 17q25.3 |
| Refseq ORF | 732 |
| Synonyms | DCR; HCR2; HCRII; KIDCR; P34H; PNTSU; SDR20C1; XR |
| Summary | The protein encoded by this gene acts as a homotetramer to catalyze diacetyl reductase and L-xylulose reductase reactions. The encoded protein may play a role in the uronate cycle of glucose metabolism and in the cellular osmoregulation in the proximal renal tubules. Defects in this gene are a cause of pentosuria. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Aug 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Pentose and glucuronate interconversions |
Documents
| FAQs |
| SDS |
