UGT2B10 (NM_001144767) Human Mass Spec Standard
CAT#: PH327991
UGT2B10 MS Standard C13 and N15-labeled recombinant protein (NP_001138239)
View other "UGT2B10" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | UGT2B10 MS Standard C13 and N15-labeled recombinant protein (NP_001138239) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227991 |
| Predicted MW | 50.5 kDa |
| Protein Sequence |
>RC227991 representing NM_001144767
Red=Cloning site Green=Tags(s) MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSST LKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQ ESRFDIVFADAYLPCGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEF VQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGH PKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVIND PSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVL FIITKCCLFCFWKFARKGKKGKRD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138239 |
| RefSeq ORF | 1332 |
| Synonyms | UDPGT2B10 |
| Locus ID | 7365 |
| Cytogenetics | 4q13.2 |
| Summary | UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
| Protein Pathways | Androgen and estrogen metabolism, Ascorbate and aldarate metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Pentose and glucuronate interconversions, Porphyrin and chlorophyll metabolism, Retinol metabolism, Starch and sucrose metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421349 | UGT2B10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428511 | UGT2B10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY421349 | Transient overexpression lysate of UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 1 |
CNY 4840.00 |
|
| LY428511 | Transient overexpression lysate of UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 2 |
CNY 3080.00 |
|
| PH323408 | UGT2B10 MS Standard C13 and N15-labeled recombinant protein (NP_001066) |
CNY 19520.00 |
|
| TP323408 | Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP327991 | Recombinant protein of human UDP glucuronosyltransferase 2 family, polypeptide B10 (UGT2B10), transcript variant 2, 20 µg |
CNY 2900.00 |
其它UGT2B10产品
