ALS2CR1 (NIF3L1) (NM_001142355) Human Mass Spec Standard
CAT＃: PH327825
NIF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001135827)
View other "ALS2CR1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | NIF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001135827) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227825 |
| Predicted MW | 42 kDa |
| Protein Sequence |
>RC227825 protein sequence
Red=Cloning site Green=Tags(s) MLSSCVRPVPTTVRFVDSLICNSSRSFMDLKALLSSLNDFASLSFAESWDNVGLLVEPSPPHTVNTLFLT NDLTEEVMEEVLQKKADLILSYHPPIFRPMKRITWNTWKERLVIRALENRVGIYSPHTAYDAAPQGVNNW LAKGLGACTSRPIHPSKAPNYPTEGNHRVEFNVNYTQDLDKVMSAVKGIDGVSVTSFSARTGNEEQTRIN LNCTQKALMQVVDFLSRNKQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLATMIDRIKRHLKLSHIRL ALGVGRTLESQVKVVALCAGSGSSVLQGVEADLYLTGEMSHHDTLDAASQGINVILCEHSNTERGFLSDL RDMLDSHLENKINIILSETDRDPLQVV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001135827 |
| RefSeq Size | 1446 |
| RefSeq ORF | 1131 |
| Synonyms | ALS2CR1; CALS-7; MDS015 |
| Locus ID | 60491 |
| Cytogenetics | 2q33.1 |
| Summary | May function as a transcriptional corepressor through its interaction with COPS2, negatively regulating the expression of genes involved in neuronal differentiation.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411906 | NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427786 | NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428055 | NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428056 | NIF3L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411906 | Transient overexpression lysate of NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 2 |
CNY 3080.00 |
|
| LY427786 | Transient overexpression lysate of NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 1 |
CNY 3080.00 |
|
| LY428055 | Transient overexpression lysate of NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 3 |
CNY 3080.00 |
|
| LY428056 | Transient overexpression lysate of NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 4 |
CNY 3080.00 |
|
| PH300827 | NIF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_068596) |
CNY 19520.00 |
|
| PH327762 | NIF3L1 MS Standard C13 and N15-labeled recombinant protein (NP_001129511) |
CNY 19520.00 |
|
| TP300827 | Recombinant protein of human NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP327762 | Recombinant protein of human NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP327825 | Recombinant protein of human NIF3 NGG1 interacting factor 3-like 1 (S. pombe) (NIF3L1), transcript variant 3, 20 µg |
CNY 2900.00 |
其它ALS2CR1产品
