BSDC1 (NM_001143890) Human Mass Spec Standard
CAT#: PH327670
BSDC1 MS Standard C13 and N15-labeled recombinant protein (NP_001137362)
View other "BSDC1" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | BSDC1 MS Standard C13 and N15-labeled recombinant protein (NP_001137362) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227670 |
| Predicted MW | 37 kDa |
| Protein Sequence |
>RC227670 representing NM_001143890
Red=Cloning site Green=Tags(s) MAEGEDVGWWRSWLQQSYQAVKEKARLYSLQSDPATYCNEPDGPPELFDAWLSQFCLEEKKGEISELLVG SPSIRALYTKMVPAAVSHSEFWHRYFYKVHQLEQEQARRDALKQRAEQSISEEPGWEEEEEELMGISPIS PKEAKVPVAKISTFPEGEPGPQSPCEENLVTSVEPPAEVTPSESSESISLVTQIANPATAPEARVLPKDL SQKLLEASLEEQGLAVDVGETGPSPPIHSKPLTPAGHTGGPEPRPPARVETLREEAPTDLRVFELNSDSG KSTPSNNGKKGSSTDISEDWEKDFDLDMTEEEVQMALSKVDASGELEDVEWEDWE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001137362 |
| RefSeq ORF | 1005 |
| Locus ID | 55108 |
| Cytogenetics | 1p35.1 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413355 | BSDC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428395 | BSDC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428396 | BSDC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428397 | BSDC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413355 | Transient overexpression lysate of BSD domain containing 1 (BSDC1), transcript variant 2 |
CNY 4840.00 |
|
| LY428395 | Transient overexpression lysate of BSD domain containing 1 (BSDC1), transcript variant 1 |
CNY 3080.00 |
|
| LY428396 | Transient overexpression lysate of BSD domain containing 1 (BSDC1), transcript variant 3 |
CNY 3080.00 |
|
| LY428397 | Transient overexpression lysate of BSD domain containing 1 (BSDC1), transcript variant 4 |
CNY 3080.00 |
|
| TP327670 | Recombinant protein of human BSD domain containing 1 (BSDC1), transcript variant 4, 20 µg |
CNY 2900.00 |
