NECAP2 (NM_001145278) Human Mass Spec Standard
CAT#: PH327668
NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138750)
View other "NECAP2" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138750) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227668 |
Predicted MW | 25.1 kDa |
Protein Sequence |
>RC227668 representing NM_001145278
Red=Cloning site Green=Tags(s) MEESGAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIE DGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMK KKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPAT ADIWGDFTKSTGSTSSQTQPGTGWVQF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001138750 |
RefSeq ORF | 711 |
Locus ID | 55707 |
Cytogenetics | 1p36.13 |
Summary | This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC428781 | NECAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428782 | NECAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY428781 | Transient overexpression lysate of NECAP endocytosis associated 2 (NECAP2), transcript variant 2 |
CNY 3080.00 |
|
LY428782 | Transient overexpression lysate of NECAP endocytosis associated 2 (NECAP2), transcript variant 3 |
CNY 3080.00 |
|
PH327659 | NECAP2 MS Standard C13 and N15-labeled recombinant protein (NP_001138749) |
CNY 19520.00 |
|
TP327659 | Recombinant protein of human NECAP endocytosis associated 2 (NECAP2), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP327668 | Recombinant protein of human NECAP endocytosis associated 2 (NECAP2), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP721003 | Purified recombinant protein of Human NECAP endocytosis associated 2 (NECAP2), transcript variant 1 |
CNY 1800.00 |