FXYD3 (NM_001136011) Human Mass Spec Standard
CAT#: PH327235
FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_001129483)
View other "FXYD3" proteins (14)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_001129483) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227235 |
Predicted MW | 9.3 kDa |
Protein Sequence |
>RC227235 protein sequence
Red=Cloning site Green=Tags(s) MQKVTLGLLVFLAGFPVLDANDLEDKNSPFYYDWHSLQVGGLICAGVLCAMGIIIVMSAKCKCKFGQKSG HHPGETPPLITPGSAQS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001129483 |
RefSeq Size | 1466 |
RefSeq ORF | 261 |
Synonyms | MAT8; PLML |
Locus ID | 5349 |
Cytogenetics | 19q13.12 |
Summary | This gene belongs to a small family of FXYD-domain containing regulators of Na+/K+ ATPases which share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD, and containing 7 invariant and 6 highly conserved amino acids. This gene encodes a cell membrane protein that may regulate the function of ion-pumps and ion-channels. This gene may also play a role in tumor progression. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Oct 2008] |
Protein Families | Ion Channels: Other, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411880 | FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC416954 | FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427762 | FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427763 | FXYD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411880 | Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 2 |
CNY 3080.00 |
|
LY416954 | Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1 |
CNY 3080.00 |
|
LY427762 | Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 7 |
CNY 3080.00 |
|
LY427763 | Transient overexpression lysate of FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 8 |
CNY 3080.00 |
|
PH313945 | FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_005962) |
CNY 19520.00 |
|
PH327269 | FXYD3 MS Standard C13 and N15-labeled recombinant protein (NP_001129484) |
CNY 19520.00 |
|
TP313945 | Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP327235 | Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 7, 20 µg |
CNY 2900.00 |
|
TP327269 | Recombinant protein of human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 8, 20 µg |
CNY 2900.00 |
|
TP761868 | Purified recombinant protein of Human FXYD domain containing ion transport regulator 3 (FXYD3), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |