SCRN1 (NM_001145513) Human Mass Spec Standard
CAT#: PH327072
SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138985)
View other "SCRN1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_001138985) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227072 |
| Predicted MW | 46.4 kDa |
| Protein Sequence |
>RC227072 protein sequence
Red=Cloning site Green=Tags(s) MAAAPPSYCFVAFPPRAKDGLVVFGKNSARPRDEVQEVVYFSAADHEPESKVECTYISIDQVPRTYAIMI SRPAWLWGAEMGANEHGVCIANEAINTREPAAEIEALLGMDLVRLGLERGETAKEALDVIVSLLEEHGQG GNYFEDANSCHSFQSAYLIVDRDEAWVLETIGKYWAAEKVTEGVRCICSQLSLTTKMDAEHPELRSYAQS QGWWTGEGEFNFSEVFSPVEDHLDCGAGKDSLEKQEESITVQTMMNTLRDKASGVCIDSEFFLTTASGVS VLPQNRSSPCIHYFTGTHDPSRSIFKPFIFVDDVKLVPKTQSPCFGDDDPAKKEPRFQEKPDRRHELYKA HEWARAIIESDQEQGRKLRSTMLELEKQGLEAMEEILTSSEPLDPAEVGDLFYDCVDTEIKFFK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138985 |
| RefSeq Size | 5286 |
| RefSeq ORF | 1242 |
| Synonyms | SES1 |
| Locus ID | 9805 |
| Cytogenetics | 7p14.3 |
| Summary | This gene likely encodes a member of the secernin family of proteins. A similar protein in rat functions in regulation of exocytosis in mast cells. Alternatively spliced transcript variants have been described. [provided by RefSeq, Mar 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414994 | SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428918 | SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428919 | SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428920 | SCRN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414994 | Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 2 |
CNY 3080.00 |
|
| LY428918 | Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 1 |
CNY 3080.00 |
|
| LY428919 | Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 3 |
CNY 3080.00 |
|
| LY428920 | Transient overexpression lysate of secernin 1 (SCRN1), transcript variant 4 |
CNY 3080.00 |
|
| PH306268 | SCRN1 MS Standard C13 and N15-labeled recombinant protein (NP_055581) |
CNY 19520.00 |
|
| TP306268 | Recombinant protein of human secernin 1 (SCRN1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP327072 | Recombinant protein of human secernin 1 (SCRN1), transcript variant 1, 20 µg |
CNY 2900.00 |


