LRRC61 (NM_001142928) Human Mass Spec Standard
CAT#: PH326959
LRRC61 MS Standard C13 and N15-labeled recombinant protein (NP_001136400)
View other "LRRC61" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | LRRC61 MS Standard C13 and N15-labeled recombinant protein (NP_001136400) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226959 |
| Predicted MW | 28 kDa |
| Protein Sequence |
>RC226959 protein sequence
Red=Cloning site Green=Tags(s) MDPPAEKPGEAGGLQITPQLLKSRTGEFSLESILLLKLRGLGLADLGCLGECLGLEWLDLSGNALTHLGP LASLRQLAVLNVSNNRLTGLEPLATCENLQSLNAAGNLLATPGQLQCLAGLPCLEYLRLRDPLARLSNPL CANPSYWAAVRELLPGLKVIDGERVIGRGSEFYQLCRDLDSSLRPSSSPGPRATEAQPWVEPGYWESWPS RSSSILEEACRQFQDTLQECWDLDRQASDSLAQAEQVLSSAGPTSSFVF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001136400 |
| RefSeq Size | 1979 |
| RefSeq ORF | 777 |
| Synonyms | HSPC295 |
| Locus ID | 65999 |
| Cytogenetics | 7q36.1 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411423 | LRRC61 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428296 | LRRC61 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411423 | Transient overexpression lysate of leucine rich repeat containing 61 (LRRC61), transcript variant 2 |
CNY 3080.00 |
|
| LY428296 | Transient overexpression lysate of leucine rich repeat containing 61 (LRRC61), transcript variant 1 |
CNY 3080.00 |
|
| PH300951 | LRRC61 MS Standard C13 and N15-labeled recombinant protein (NP_076431) |
CNY 19520.00 |
|
| TP300951 | Recombinant protein of human leucine rich repeat containing 61 (LRRC61), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP326959 | Recombinant protein of human leucine rich repeat containing 61 (LRRC61), transcript variant 1, 20 µg |
CNY 2900.00 |
