RNASEH2B (NM_001142279) Human Mass Spec Standard
CAT#: PH326833
RNASEH2B MS Standard C13 and N15-labeled recombinant protein (NP_001135751)
View other "RNASEH2B" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RNASEH2B MS Standard C13 and N15-labeled recombinant protein (NP_001135751) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226833 |
| Predicted MW | 28.8 kDa |
| Protein Sequence |
>RC226833 representing NM_001142279
Red=Cloning site Green=Tags(s) MAAGVDCGDGVGARQHVFLVSEYLKDASKKMKNGLMFVKLVNPCSGEGAIYLFNMCLQQLFEVKVFKEKH HSWFINQSVQSGGLLHFATPVDPLFLLLHYLIKADKEGKFQPLDQVVVDNVFPNCILLLKLPGLEKLLHH VTEEKGNPEIDNKKYYKYSKEKTLKWLEKKVNQTVAALKTNNVNVSSRVQSTAFFSGDQASTDKEEDYIR YAHGLISDYIPKELSDDLSKYLKLPEPSASLPNPPSKMAAQRQKRGK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001135751 |
| RefSeq ORF | 771 |
| Synonyms | AGS2; DLEU8 |
| Locus ID | 79621 |
| Cytogenetics | 13q14.3 |
| Summary | RNase H2 is composed of a single catalytic subunit (A) and two non-catalytic subunits (B and C) and specifically degrades the RNA of RNA:DNA hybrids. The protein encoded by this gene is the non-catalytic B subunit of RNase H2, which is thought to play a role in DNA replication. Multiple transcript variants encoding different isoforms have been found for this gene. Defects in this gene are a cause of Aicardi-Goutieres syndrome type 2 (AGS2). [provided by RefSeq, Nov 2008] |
| Protein Pathways | DNA replication |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411236 | RNASEH2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428003 | RNASEH2B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411236 | Transient overexpression lysate of ribonuclease H2, subunit B (RNASEH2B), transcript variant 1 |
CNY 3080.00 |
|
| LY428003 | Transient overexpression lysate of ribonuclease H2, subunit B (RNASEH2B), transcript variant 2 |
CNY 3080.00 |
|
| TP326833 | Recombinant protein of human ribonuclease H2, subunit B (RNASEH2B), transcript variant 2, 20 µg |
CNY 2900.00 |
其它RNASEH2B产品
