FAM76A (NM_001143914) Human Mass Spec Standard
CAT＃: PH326773
FAM76A MS Standard C13 and N15-labeled recombinant protein (NP_001137386)
View other "FAM76A" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Product images
Specifications
| Product Data | |
| Description | FAM76A MS Standard C13 and N15-labeled recombinant protein (NP_001137386) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226773 |
| Predicted MW | 31.7 kDa |
| Protein Sequence |
>RC226773 representing NM_001143914
Red=Cloning site Green=Tags(s) MAALYACTKCHQRFPFEALSQGQQLCKECRIAHPVVKCTYCRTEYQQESKTNTICKKCAQNVQLYGTPKP CQYCNIIAAFIGNKCQRCTNSEKKYGPPYSCEQCKQQCAFDRKDDRKKVDGKLLCWLCTLSYKRVLQKTK EQRKHLSSSSRAGHQEKEQYSRLSGGGHYNSFSPDLALDSPGTDHFVIIAQLKEEVATLKKMLHQKDQMI LEKEKKITELKADFQYQESQMRAKMNQMEKTHKEVTEQLQAKNRELLKQAAALSKSKKSEKSGAITSP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001137386 |
| RefSeq ORF | 834 |
| Locus ID | 199870 |
| Cytogenetics | 1p35.3 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407384 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428401 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428402 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428403 | FAM76A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407384 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 3 |
CNY 3080.00 |
|
| LY428401 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 1 |
CNY 3080.00 |
|
| LY428402 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 2 |
CNY 3080.00 |
|
| LY428403 | Transient overexpression lysate of family with sequence similarity 76, member A (FAM76A), transcript variant 4 |
CNY 3080.00 |
|
| PH306630 | FAM76A MS Standard C13 and N15-labeled recombinant protein (NP_689873) |
CNY 19520.00 |
|
| TP306630 | Recombinant protein of human family with sequence similarity 76, member A (FAM76A), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP326773 | Purified recombinant protein of Homo sapiens family with sequence similarity 76, member A (FAM76A), transcript variant 4, 20 µg |
CNY 2900.00 |
