EFCAB2 (NM_001143943) Human Mass Spec Standard
CAT#: PH326751
EFCAB2 MS Standard C13 and N15-labeled recombinant protein (NP_001137415)
View other "EFCAB2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
CNY 3080.00
Specifications
Product Data | |
Description | EFCAB2 MS Standard C13 and N15-labeled recombinant protein (NP_001137415) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226751 |
Predicted MW | 15.3 kDa |
Protein Sequence |
>RC226751 representing NM_001143943
Red=Cloning site Green=Tags(s) MADEKDREEIIVAEFHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCCPTEGELHDLIAEVEEEEPTGY IRFEKFLPVMTEILLERKYRPIPEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEDGVSLRRPG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001137415 |
RefSeq ORF | 399 |
Synonyms | CFAP200; DRC8 |
Locus ID | 84288 |
Cytogenetics | 1q44 |
Summary | The gene encodes a protein that contains two EF-hand calcium-binding domains although its function has yet to be determined. Alternatively spliced transcripts have been observed. [provided by RefSeq, Mar 2014] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410204 | EFCAB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC428415 | EFCAB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410204 | Transient overexpression lysate of EF-hand calcium binding domain 2 (EFCAB2), transcript variant 1 |
CNY 3080.00 |
|
LY428415 | Transient overexpression lysate of EF-hand calcium binding domain 2 (EFCAB2), transcript variant 2 |
CNY 3080.00 |
|
PH302779 | EFCAB2 MS Standard C13 and N15-labeled recombinant protein (NP_115704) |
CNY 19520.00 |
|
TP302779 | Recombinant protein of human EF-hand calcium binding domain 2 (EFCAB2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP326751 | Purified recombinant protein of Homo sapiens EF-hand calcium binding domain 2 (EFCAB2), transcript variant 2, 20 µg |
CNY 2900.00 |