GDNF Receptor alpha 1 (GFRA1) (NM_001145453) Human Mass Spec Standard
CAT＃: PH326704
GFRA1 MS Standard C13 and N15-labeled recombinant protein (NP_001138925)
View other "GDNF Receptor alpha 1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | GFRA1 MS Standard C13 and N15-labeled recombinant protein (NP_001138925) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226704 |
| Predicted MW | 50.84 kDa |
| Protein Sequence |
>RC226704 representing NM_001145453
Red=Cloning site Green=Tags(s) MFLATLYFALPLLDLLLSAEVSGGDRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKD ECRSAMEALKQKSLYNCRCKRGMKKEKNCLRIYWSMYQSLQGNDLLEDSPYEPVNSRLSDIFRVVPFISV EHIPKGNNCLDAAKACNLDDICKKYRSAYITPCTTSVSNDVCNRRKCHKALRQFFDKVPAKHSYGMLFCS CRDIACTERRRQTIVPVCSYEEREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADC LLAYSGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVWQ PAFPVQTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGNYEKEGL GASSHITTKSMAAPPSCGLSPLLVLVVTALSTLLSLTETS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138925 |
| RefSeq ORF | 1380 |
| Synonyms | GDNFR; GDNFRA; GFR-ALPHA-1; GFRalpha-1; RET1L; RETL1; TRNR1 |
| Locus ID | 2674 |
| Cytogenetics | 10q25.3 |
| Summary | This gene encodes a member of the glial cell line-derived neurotrophic factor receptor (GDNFR) family of proteins. The encoded preproprotein is proteolytically processed to generate the mature receptor. Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. This receptor is a glycosylphosphatidylinositol (GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This gene is a candidate gene for Hirschsprung disease. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed. [provided by RefSeq, Jan 2016] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407880 | GFRA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417417 | GFRA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC428898 | GFRA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407880 | Transient overexpression lysate of GDNF family receptor alpha 1 (GFRA1), transcript variant 2 |
CNY 3080.00 |
|
| LY417417 | Transient overexpression lysate of GDNF family receptor alpha 1 (GFRA1), transcript variant 1 |
CNY 4840.00 |
|
| LY428898 | Transient overexpression lysate of GDNF family receptor alpha 1 (GFRA1), transcript variant 3 |
CNY 3080.00 |
|
| TP326704 | Recombinant protein of human GDNF family receptor alpha 1 (GFRA1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP720395 | Recombinant protein of human GDNF family receptor alpha 1 (GFRA1), transcript variant 3 |
CNY 1800.00 |
其它GDNF Receptor alpha 1产品
