Ataxin 1 (ATXN1) (NM_001128164) Human Mass Spec Standard
CAT#: PH326185
ATXN1 MS Standard C13 and N15-labeled recombinant protein (NP_001121636)
View other "Ataxin 1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ATXN1 MS Standard C13 and N15-labeled recombinant protein (NP_001121636) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226185 |
Predicted MW | 86.9 kDa |
Protein Sequence |
>RC226185 protein sequence
Red=Cloning site Green=Tags(s) MKSNQERSNECLPPKKREIPATSRSSEEKAPTLPSDNHRVEGTAWLPGNPGGRGHGGGRHGPAGTSVELG LQQGIGLHKALSTGLDYSPPSAPRSVPVATTLPAAYATPQPGTPVSPVQYAHLPHTFQFIGSSQYSGTYA SFIPSQLIPPTANPVTSAVASAAGATTPSQRSQLEAYSTLLANMGSLSQTPGHKAEQQQQQQQQQQQQHQ HQQQQQQQQQQQQQQHLSRAPGLITPGSPPPAQQNQYVHISSSPQNTGRTASPPAIPVHLHPHQTMIPHT LTLGPPSQVVMQYADSGSHFVPREATKKAESSRLQQAIQAKEVLNGEMEKSRRYGAPSSADLGLGKAGGK SVPHPYESRHVVVHPSPSDYSSRDPSGVRASVMVLPNSNTPAADLEVQQATHREASPSTLNDKSGLHLGK PGHRSYALSPHTVIQTTHSASEPLPVGLPATAFYAGTQPPVIGYLSGQQQAITYAGSLPQHLVIPGTQPL LIPVGSTDMEASGAAPAIVTSSPQFAAVPHTFVTTALPKSENFNPEALVTQAAYPAMVQAQIHLPVVQSV ASPAAAPPTLPPYFMKGSIIQLANGELKKVEDLKTEDFIQSAEISNDLKIDSSTVERIEDSHSPGVAVIQ FAVGEHRAQVSVEVLVEYPFFVFGQGWSSCCPERTSQLFDLPCSKLSVGDVCISLTLKNLKNGSVKKGQP VDPASVLLKHSKADGLAGSRHRYAEQENGINQGSAQMLSENGELKFPEKMGLPAAPFLTKIEPSKPAATR KRRWSAPESRKLEKSEDEPPLTLPKPSLIPQEVKICIEGRSNVGK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001121636 |
RefSeq Size | 10587 |
RefSeq ORF | 2445 |
Synonyms | ATX1; D6S504E; SCA1 |
Locus ID | 6310 |
Cytogenetics | 6p22.3 |
Summary | The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the `pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted to successive generations. The function of the ataxins is not known. This locus has been mapped to chromosome 6, and it has been determined that the diseased allele contains 40-83 CAG repeats, compared to 6-39 in the normal allele, and is associated with spinocerebellar ataxia type 1 (SCA1). Alternative splicing results in multiple transcript variants, with one variant encoding multiple distinct proteins, ATXN1 and Alt-ATXN1, due to the use of overlapping alternate reading frames. [provided by RefSeq, Nov 2017] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424789 | ATXN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC426904 | ATXN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY424789 | Transient overexpression lysate of ataxin 1 (ATXN1), transcript variant 1 |
CNY 4840.00 |
|
LY426904 | Transient overexpression lysate of ataxin 1 (ATXN1), transcript variant 2 |
CNY 4840.00 |
|
PH322862 | ATXN1 MS Standard C13 and N15-labeled recombinant protein (NP_000323) |
CNY 19520.00 |
|
TP322862 | Recombinant protein of human ataxin 1 (ATXN1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP326185 | Recombinant protein of human ataxin 1 (ATXN1), transcript variant 2, 20 µg |
CNY 2900.00 |
其它Ataxin 1产品