PPOX (NM_001122764) Human Mass Spec Standard
CAT＃: PH325811
PPOX MS Standard C13 and N15-labeled recombinant protein (NP_001116236)
View other "PPOX" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | PPOX MS Standard C13 and N15-labeled recombinant protein (NP_001116236) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225811 |
| Predicted MW | 50.8 kDa |
| Protein Sequence |
>RC225811 protein sequence
Red=Cloning site Green=Tags(s) MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPNGAIFELGPRGIRPAGALGAR TLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGK EPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSIRSCFPSLFQAEQTHRSILLGLLLGAGRTPQ PDSALIRQALAERWSQWSLRGGLEMLPQALETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEAD HVISAIPASVLSELLPAEAAPLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDS VAFPEQDGSPPGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIP QYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001116236 |
| RefSeq Size | 1777 |
| RefSeq ORF | 1431 |
| Synonyms | PPO; V290M; VP |
| Locus ID | 5498 |
| Cytogenetics | 1q23.3 |
| Summary | This gene encodes the penultimate enzyme of heme biosynthesis, which catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX. Mutations in this gene cause variegate porphyria, an autosomal dominant disorder of heme metabolism resulting from a deficiency in protoporphyrinogen oxidase, an enzyme located on the inner mitochondrial membrane. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Porphyrin and chlorophyll metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424808 | PPOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426558 | PPOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424808 | Transient overexpression lysate of protoporphyrinogen oxidase (PPOX), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| LY426558 | Transient overexpression lysate of protoporphyrinogen oxidase (PPOX), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| PH301788 | PPOX MS Standard C13 and N15-labeled recombinant protein (NP_000300) |
CNY 19520.00 |
|
| TP301788 | Recombinant protein of human protoporphyrinogen oxidase (PPOX), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325811 | Recombinant protein of human protoporphyrinogen oxidase (PPOX), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2900.00 |
