Chk1 (CHEK1) (NM_001114122) Human Mass Spec Standard
CAT#: PH325807
CHEK1 MS Standard C13 and N15-labeled recombinant protein (NP_001107594)
View other "Chk1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | CHEK1 MS Standard C13 and N15-labeled recombinant protein (NP_001107594) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225807 |
| Predicted MW | 54.4 kDa |
| Protein Sequence |
>RC225807 protein sequence
Red=Cloning site Green=Tags(s) MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINKMLNHENVVKF YGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVYLHGIGITHRDIKPENLLLDE RDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPWDQ PSDSCQEYSDWKEKKTYLNPWKKIDSAPLALLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTS GGVSESPSGFSKHIQSNLDFSPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCP DHMLLNSQLLGTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKVWLPAT myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001107594 |
| RefSeq Size | 4174 |
| RefSeq ORF | 1428 |
| Synonyms | CHK1 |
| Locus ID | 1111 |
| Cytogenetics | 11q24.2 |
| Summary | The protein encoded by this gene belongs to the Ser/Thr protein kinase family. It is required for checkpoint mediated cell cycle arrest in response to DNA damage or the presence of unreplicated DNA. This protein acts to integrate signals from ATM and ATR, two cell cycle proteins involved in DNA damage responses, that also associate with chromatin in meiotic prophase I. Phosphorylation of CDC25A protein phosphatase by this protein is required for cells to delay cell cycle progression in response to double-strand DNA breaks. Several alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011] |
| Protein Families | Druggable Genome, Protein Kinase, Stem cell - Pluripotency |
| Protein Pathways | Cell cycle, p53 signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400510 | CHEK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426457 | CHEK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426458 | CHEK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400510 | Transient overexpression lysate of CHK1 checkpoint homolog (S. pombe) (CHEK1), transcript variant 1 |
CNY 3080.00 |
|
| LY426457 | Transient overexpression lysate of CHK1 checkpoint homolog (S. pombe) (CHEK1), transcript variant 2 |
CNY 3080.00 |
|
| LY426458 | Transient overexpression lysate of CHK1 checkpoint homolog (S. pombe) (CHEK1), transcript variant 3 |
CNY 3080.00 |
|
| TP325807 | Purified recombinant protein of Homo sapiens CHK1 checkpoint homolog (S. pombe) (CHEK1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP762547 | Purified recombinant protein of Human CHK1 checkpoint homolog (S.pombe) (CHEK1), transcript variant 1, 50ug |
CNY 2480.00 |


