Thyroid Hormone Receptor beta (THRB) (NM_001128176) Human Mass Spec Standard
CAT#: PH325776
THRB MS Standard C13 and N15-labeled recombinant protein (NP_001121648)
View other "Thyroid Hormone Receptor beta" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | THRB MS Standard C13 and N15-labeled recombinant protein (NP_001121648) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225776 |
Predicted MW | 52.8 kDa |
Protein Sequence |
>RC225776 protein sequence
Red=Cloning site Green=Tags(s) MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHL DHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLH PSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGH KPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAI TRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVS DAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001121648 |
RefSeq Size | 7527 |
RefSeq ORF | 1383 |
Synonyms | C-ERBA-2; C-ERBA-BETA; ERBA2; GRTH; NR1A2; PRTH; THR1; THRB1; THRB2; TRbeta |
Locus ID | 7068 |
Cytogenetics | 3p24.2 |
Summary | The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Mutations in this gene are known to be a cause of generalized thyroid hormone resistance (GTHR), a syndrome characterized by goiter and high levels of circulating thyroid hormone (T3-T4), with normal or slightly elevated thyroid stimulating hormone (TSH). Several alternatively spliced transcript variants encoding the same protein have been observed for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Protein Pathways | Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400163 | THRB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LC426913 | THRB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426914 | THRB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400163 | Transient overexpression lysate of thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 1 |
CNY 4840.00 |
|
LY426913 | Transient overexpression lysate of thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2 |
CNY 3080.00 |
|
LY426914 | Transient overexpression lysate of thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3 |
CNY 3080.00 |
|
TP325776 | Recombinant protein of human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP761476 | Purified recombinant protein of Human thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a) oncogene homolog 2, avian) (THRB), transcript variant 3, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2040.00 |
其它Thyroid Hormone Receptor beta产品