ALDH3A1 (NM_001135168) Human Mass Spec Standard
CAT#: PH325751
ALDH3A1 MS Standard C13 and N15-labeled recombinant protein (NP_001128640)
View other "ALDH3A1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | ALDH3A1 MS Standard C13 and N15-labeled recombinant protein (NP_001128640) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225751 |
| Predicted MW | 50.2 kDa |
| Protein Sequence |
>RC225751 representing NM_001135168
Red=Cloning site Green=Tags(s) MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAYYEEVVYVLEE IEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNLTIQPMVGAIAAGNSVVLKPS ELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKERFDHILYTGSTGVGKIIMTAAAKHLTPVTLE LGGKSPCYVDKNCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSR DYGRIISARHFQRVMGLIEGQKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEE AIQFINQREKPLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001128640 |
| RefSeq ORF | 1359 |
| Synonyms | ALDH3; ALDHIII |
| Locus ID | 218 |
| Cytogenetics | 17p11.2 |
| Summary | Aldehyde dehydrogenases oxidize various aldehydes to the corresponding acids. They are involved in the detoxification of alcohol-derived acetaldehyde and in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. The enzyme encoded by this gene forms a cytoplasmic homodimer that preferentially oxidizes aromatic and medium-chain (6 carbons or more) saturated and unsaturated aldehyde substrates. It is thought to promote resistance to UV and 4-hydroxy-2-nonenal-induced oxidative damage in the cornea. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Sep 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Drug metabolism - cytochrome P450, Glycolysis / Gluconeogenesis, Histidine metabolism, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Phenylalanine metabolism, Tyrosine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400232 | ALDH3A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427569 | ALDH3A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427570 | ALDH3A1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400232 | Transient overexpression lysate of aldehyde dehydrogenase 3 family, memberA1 (ALDH3A1), transcript variant 2 |
CNY 3080.00 |
|
| LY427569 | Transient overexpression lysate of aldehyde dehydrogenase 3 family, memberA1 (ALDH3A1), transcript variant 3 |
CNY 3080.00 |
|
| LY427570 | Transient overexpression lysate of aldehyde dehydrogenase 3 family, memberA1 (ALDH3A1), transcript variant 1 |
CNY 3080.00 |
|
| PH302440 | ALDH3A1 MS Standard C13 and N15-labeled recombinant protein (NP_000682) |
CNY 19520.00 |
|
| PH325750 | ALDH3A1 MS Standard C13 and N15-labeled recombinant protein (NP_001128639) |
CNY 19520.00 |
|
| TP302440 | Recombinant protein of human aldehyde dehydrogenase 3 family, memberA1 (ALDH3A1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP325750 | Recombinant protein of human aldehyde dehydrogenase 3 family, memberA1 (ALDH3A1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
| TP325751 | Recombinant protein of human aldehyde dehydrogenase 3 family, memberA1 (ALDH3A1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它ALDH3A1产品
