CCBL1 (KYAT1) (NM_001122671) Human Mass Spec Standard
CAT#: PH325677
CCBL1 MS Standard C13 and N15-labeled recombinant protein (NP_001116143)
View other "CCBL1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CCBL1 MS Standard C13 and N15-labeled recombinant protein (NP_001116143) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225677 |
| Predicted MW | 47.7 kDa |
| Protein Sequence |
>RC225677 representing NM_001122671
Red=Cloning site Green=Tags(s) MAKQLQARRLDGIDYNPWVEFVKLASEHDVVNLGQGFPDFPPPDFAVEAFQHAVSGDFMLNQYTKTFGYP PLTKILASFFGELLGQEIDPLRNVLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPV FVSLKPGPIQNGELGSSSNWQLDPMELAGKFTSRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVC ITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHC PTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRK MPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKV EL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001116143 |
| RefSeq ORF | 1266 |
| Synonyms | CCBL1; GTK; KAT1; KATI |
| Locus ID | 883 |
| Cytogenetics | 9q34.11 |
| Summary | This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401315 | CCBL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC426545 | CCBL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401315 | Transient overexpression lysate of cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 1 |
CNY 4840.00 |
|
| LY426545 | Transient overexpression lysate of cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 2 |
CNY 3080.00 |
|
| PH316317 | CCBL1 MS Standard C13 and N15-labeled recombinant protein (NP_004050) |
CNY 19520.00 |
|
| TP316317 | Recombinant protein of human cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325677 | Recombinant protein of human cysteine conjugate-beta lyase, cytoplasmic (CCBL1), transcript variant 2, 20 µg |
CNY 2900.00 |
