CAB39 (NM_001130849) Human Mass Spec Standard
CAT#: PH325504
CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_001124321)
View other "CAB39" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_001124321) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225504 |
| Predicted MW | 39.9 kDa |
| Protein Sequence |
>RC225504 protein sequence
Red=Cloning site Green=Tags(s) MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQL AQELYNSGLLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPEIA LNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHKLLSAEFLEQHYDRF FSEYEKLLHSENYVTKRQSLKLLGELLLDRHNFTIMTKYISKPENLKLMMNLLRDKSRNIQFEAFHVFKV FVANPNKTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRPAQQEA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001124321 |
| RefSeq Size | 3968 |
| RefSeq ORF | 1023 |
| Synonyms | CGI-66; MO25 |
| Locus ID | 51719 |
| Cytogenetics | 2q37.1 |
| Summary | Component of a complex that binds and activates STK11/LKB1. In the complex, required to stabilize the interaction between CAB39/MO25 (CAB39/MO25alpha or CAB39L/MO25beta) and STK11/LKB1.[UniProtKB/Swiss-Prot Function] |
| Protein Pathways | mTOR signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402536 | CAB39 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427286 | CAB39 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427287 | CAB39 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402536 | Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 1 |
CNY 3080.00 |
|
| LY427286 | Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 2 |
CNY 3080.00 |
|
| LY427287 | Transient overexpression lysate of calcium binding protein 39 (CAB39), transcript variant 3 |
CNY 3080.00 |
|
| PH304563 | CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_057373) |
CNY 19520.00 |
|
| PH325505 | CAB39 MS Standard C13 and N15-labeled recombinant protein (NP_001124322) |
CNY 19520.00 |
|
| TP304563 | Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325504 | Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP325505 | Recombinant protein of human calcium binding protein 39 (CAB39), transcript variant 3, 20 µg |
CNY 2900.00 |
