RELL2 (NM_001130029) Human Mass Spec Standard
CAT＃: PH325425
RELL2 MS Standard C13 and N15-labeled recombinant protein (NP_001123501)
View other "RELL2" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | RELL2 MS Standard C13 and N15-labeled recombinant protein (NP_001123501) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225425 |
| Predicted MW | 32.5 kDa |
| Protein Sequence |
>RC225425 protein sequence
Red=Cloning site Green=Tags(s) MSEPQPDLEPPQHGLYMLFLLVLVFFLMGLVGFMICHVLKKKGYRCRTSRGSEPDDAQLQPPEDDDMNED TVERIVRCIIQNEANAEALKEMLGDSEGEGTVQLSSVDATSSLQDGAPSHHHTVHLGPAAPCIHCSRSKR PPLVRQGRSKEGKSRPRTGETTVFSVGRFRVTHIEKRYGLHEHRDGSPTDRSWGSRGGQDPGGGQGSGGG QPKAGMPAMERLPPERPQPQVLASPPVQNGGLRDSSLTPRALEGNPRASAEPTLRAGGRGPSPGLPTQEA NGEPSKPDTSDHQVSLPQGAGSM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001123501 |
| RefSeq Size | 2171 |
| RefSeq ORF | 909 |
| Synonyms | C5orf16 |
| Locus ID | 285613 |
| Cytogenetics | 5q31.3 |
| Summary | Induces activation of MAPK14/p38 cascade, when overexpressed (PubMed:28688764). Induces apoptosis, when overexpressed (PubMed:19969290).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406433 | RELL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427113 | RELL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406433 | Transient overexpression lysate of RELT-like 2 (RELL2), transcript variant 1 |
CNY 3080.00 |
|
| LY427113 | Transient overexpression lysate of RELT-like 2 (RELL2), transcript variant 2 |
CNY 3080.00 |
|
| PH308967 | RELL2 MS Standard C13 and N15-labeled recombinant protein (NP_776189) |
CNY 19520.00 |
|
| TP308967 | Recombinant protein of human RELT-like 2 (RELL2), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325425 | Recombinant protein of human RELT-like 2 (RELL2), transcript variant 2, 20 µg |
CNY 2900.00 |
