MPST (NM_001130517) Human Mass Spec Standard
CAT#: PH325408
MPST MS Standard C13 and N15-labeled recombinant protein (NP_001123989)
View other "MPST" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | MPST MS Standard C13 and N15-labeled recombinant protein (NP_001123989) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225408 |
| Predicted MW | 33.2 kDa |
| Protein Sequence |
>RC225408 protein sequence
Red=Cloning site Green=Tags(s) MASPQLCRALVSAQWVAEALRAPRAGQPLQLLDASWYLPKLGRDARREFEERHIPGAAFFDIDQCSDRTS PYDHMLPGAEHFAEYAGRLGVGAATHVVIYDASDQGLYSAPRVWWMFRAFGHHAVSLLDGGLRHWLRQNL PLSSGKSQPAPAEFRAQLDPAFIKTYEDIKENLESRRFQVVDSRATGRFRGTEPEPRDGIEPGHIPGTVN IPFTDFLSQEGLEKSPEEIRHLFQEKKVDLSKPLVATCGSGVTACHVALGAYLCGKPDVPIYDGSWVEWY MRARPEDVISEGRGKTH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001123989 |
| RefSeq Size | 1547 |
| RefSeq ORF | 891 |
| Synonyms | MST; TST2; TUM1 |
| Locus ID | 4357 |
| Cytogenetics | 22q12.3 |
| Summary | This protein encoded by this gene catalyzes the transfer of a sulfur ion from 3-mercaptopyruvate to cyanide or other thiol compounds. It may be involved in cysteine degradation and cyanide detoxification. There is confusion in literature between this protein (mercaptopyruvate sulfurtransferase, MPST), which appears to be cytoplasmic, and thiosulfate sulfurtransferase (rhodanese, TST, GeneID:7263), which is a mitochondrial protein. Deficiency in MPST activity has been implicated in a rare inheritable disorder known as mercaptolactate-cysteine disulfiduria (MCDU). Alternatively spliced transcript variants encoding same or different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Cysteine and methionine metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412074 | MPST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422973 | MPST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422977 | MPST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427224 | MPST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412074 | Transient overexpression lysate of mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| LY422973 | Transient overexpression lysate of mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| LY422977 | Transient overexpression lysate of mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| LY427224 | Transient overexpression lysate of mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3080.00 |
|
| PH302466 | MPST MS Standard C13 and N15-labeled recombinant protein (NP_001013454) |
CNY 19520.00 |
|
| PH305101 | MPST MS Standard C13 and N15-labeled recombinant protein (NP_066949) |
CNY 19520.00 |
|
| PH324963 | MPST MS Standard C13 and N15-labeled recombinant protein (NP_001013458) |
CNY 19520.00 |
|
| TP302466 | Recombinant protein of human mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP305101 | Recombinant protein of human mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP324963 | Recombinant protein of human mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325408 | Recombinant protein of human mercaptopyruvate sulfurtransferase (MPST), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CNY 2900.00 |
