HCCS (NM_001122608) Human Mass Spec Standard
CAT#: PH325362
HCCS MS Standard C13 and N15-labeled recombinant protein (NP_001116080)
View other "HCCS" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | HCCS MS Standard C13 and N15-labeled recombinant protein (NP_001116080) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225362 |
| Predicted MW | 30.4 kDa |
| Protein Sequence |
>RC225362 representing NM_001122608
Red=Cloning site Green=Tags(s) MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRG TAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDE DISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDR HDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001116080 |
| RefSeq ORF | 804 |
| Synonyms | CCHL; LSDMCA1; MCOPS7; MLS |
| Locus ID | 3052 |
| Cytogenetics | Xp22.2 |
| Summary | The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2010] |
| Protein Pathways | Porphyrin and chlorophyll metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC426535 | HCCS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY426535 | Transient overexpression lysate of holocytochrome c synthase (cytochrome c heme-lyase) (HCCS), transcript variant 2 |
CNY 3080.00 |
|
| TP325362 | Recombinant protein of human holocytochrome c synthase (cytochrome c heme-lyase) (HCCS), 20 µg |
CNY 2900.00 |
