THTPA (NM_001126339) Human Mass Spec Standard
CAT#: PH325287
THTPA MS Standard C13 and N15-labeled recombinant protein (NP_001119811)
View other "THTPA" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | THTPA MS Standard C13 and N15-labeled recombinant protein (NP_001119811) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225287 |
| Predicted MW | 25.6 kDa |
| Protein Sequence |
>RC225287 protein sequence
Red=Cloning site Green=Tags(s) MAQGLIEVERKFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDSGWELKCPGAA GVLGPHTEYKELTAEPTIVAQLCKVLRADGLGAGDVAAVLGPLGLQEVASFVTKRSAWKLVLLGADEEEP QLRVDLDTADFGYAVGEVEALVHEEAEVPTALEKIHRLSSMLGVPAQETAPAKLIVYLQRFRPQDYQRLL EVNSSRERPQETEDPDHCLG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001119811 |
| RefSeq Size | 1829 |
| RefSeq ORF | 690 |
| Synonyms | THTP; THTPASE |
| Locus ID | 79178 |
| Cytogenetics | 14q11.2 |
| Summary | This gene encodes an enzyme which catalyzes the biosynthesis of thiamine disphophate (vitamin B1) by hydrolysis of thiamine triphosphate. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2011] |
| Protein Pathways | Metabolic pathways, Thiamine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411308 | THTPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426679 | THTPA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411308 | Transient overexpression lysate of thiamine triphosphatase (THTPA), transcript variant 1 |
CNY 3080.00 |
|
| LY426679 | Transient overexpression lysate of thiamine triphosphatase (THTPA), transcript variant 2 |
CNY 3080.00 |
|
| PH300849 | THTPA MS Standard C13 and N15-labeled recombinant protein (NP_077304) |
CNY 19520.00 |
|
| TP300849 | Recombinant protein of human thiamine triphosphatase (THTPA), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325287 | Recombinant protein of human thiamine triphosphatase (THTPA), transcript variant 2, 20 µg |
CNY 2900.00 |
