MAD2L2 (NM_001127325) Human Mass Spec Standard
CAT#: PH325253
MAD2L2 MS Standard C13 and N15-labeled recombinant protein (NP_001120797)
View other "MAD2L2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | MAD2L2 MS Standard C13 and N15-labeled recombinant protein (NP_001120797) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225253 |
Predicted MW | 24.3 kDa |
Protein Sequence |
>RC225253 protein sequence
Red=Cloning site Green=Tags(s) MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHC VKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHN PPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKG S myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001120797 |
RefSeq Size | 1196 |
RefSeq ORF | 633 |
Synonyms | FANCV; MAD2B; POLZ2; REV7 |
Locus ID | 10459 |
Cytogenetics | 1p36.22 |
Summary | The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle, Oocyte meiosis, Progesterone-mediated oocyte maturation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416709 | MAD2L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426747 | MAD2L2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416709 | Transient overexpression lysate of MAD2 mitotic arrest deficient-like 2 (yeast) (MAD2L2), transcript variant 2 |
CNY 3080.00 |
|
LY426747 | Transient overexpression lysate of MAD2 mitotic arrest deficient-like 2 (yeast) (MAD2L2), transcript variant 1 |
CNY 3080.00 |
|
TP325253 | Recombinant protein of human MAD2 mitotic arrest deficient-like 2 (yeast) (MAD2L2), transcript variant 1, 20 µg |
CNY 2900.00 |