RWDD3 (NM_001128142) Human Mass Spec Standard
CAT#: PH325219
RWDD3 MS Standard C13 and N15-labeled recombinant protein (NP_001121614)
View other "RWDD3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
| Product Data | |
| Description | RWDD3 MS Standard C13 and N15-labeled recombinant protein (NP_001121614) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225219 |
| Predicted MW | 21.9 kDa |
| Protein Sequence |
>RC225219 representing NM_001128142
Red=Cloning site Green=Tags(s) MAEPVQEELSVLAAIFCRPHEWEVLSRSETDGTVFRIHTKAEGFMDADIPLELVFHLPVNYPSCLPGISI NSEQLTRAQCVTVKENLLEQAESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLW ITLLHLDHMRAKTKYVKIVEKWASDLRLTGRLMFMGKIILILLQGDRNNLKVPKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001121614 |
| RefSeq ORF | 585 |
| Synonyms | RSUME |
| Locus ID | 25950 |
| Cytogenetics | 1p21.3 |
| Summary | Enhancer of SUMO conjugation. Via its interaction with UBE2I/UBC9, increases SUMO conjugation to proteins by promoting the binding of E1 and E2 enzymes, thioester linkage between SUMO and UBE2I/UBC9 and transfer of SUMO to specific target proteins which include HIF1A, PIAS, NFKBIA, NR3C1 and TOP1. Isoform 1 and isoform 2 positively regulate the NF-kappa-B signaling pathway by enhancing the sumoylation of NF-kappa-B inhibitor alpha (NFKBIA), promoting its stabilization which consequently leads to an increased inhibition of NF-kappa-B transcriptional activity. Isoform 1 and isoform 2 negatively regulate the hypoxia-inducible factor-1 alpha (HIF1A) signaling pathway by increasing the sumoylation of HIF1A, promoting its stabilization, transcriptional activity and the expression of its target gene VEGFA during hypoxia. Isoform 2 promotes the sumoylation and transcriptional activity of the glucocorticoid receptor NR3C1 and enhances the interaction of SUMO1 and NR3C1 with UBE2I/UBC9. Has no effect on ubiquitination.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414519 | RWDD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426894 | RWDD3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414519 | Transient overexpression lysate of RWD domain containing 3 (RWDD3), transcript variant 1 |
CNY 3080.00 |
|
| LY426894 | Transient overexpression lysate of RWD domain containing 3 (RWDD3), transcript variant 2 |
CNY 3080.00 |
|
| TP325219 | Recombinant protein of human RWD domain containing 3 (RWDD3), transcript variant 2, 20 µg |
CNY 2900.00 |
