PHR1 (PLEKHB1) (NM_001130035) Human Mass Spec Standard
CAT#: PH325204
PLEKHB1 MS Standard C13 and N15-labeled recombinant protein (NP_001123507)
View other "PHR1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
| Product Data | |
| Description | PLEKHB1 MS Standard C13 and N15-labeled recombinant protein (NP_001123507) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225204 |
| Predicted MW | 21.1 kDa |
| Protein Sequence |
>RC225204 representing NM_001130035
Red=Cloning site Green=Tags(s) MALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQDEEDRVLIHFNVRDIKIGPECHDVQPPEG RSRDGLLTVNLREGGRLHLCAETKDDALAWKTALLEANSTPVRVYSPYQDYYEVVPPNAHEATYVRSYYG PPYAGPGVTHVIVREDPCYSAGAPLAMGMLAGAATGAALGSLMWSPCWF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001123507 |
| RefSeq ORF | 567 |
| Synonyms | KPL1; PHR1; PHRET1 |
| Locus ID | 58473 |
| Cytogenetics | 11q13.4 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412039 | PLEKHB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427118 | PLEKHB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412039 | Transient overexpression lysate of pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 1 |
CNY 3080.00 |
|
| LY427118 | Transient overexpression lysate of pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 4 |
CNY 3080.00 |
|
| PH316627 | PLEKHB1 MS Standard C13 and N15-labeled recombinant protein (NP_067023) |
CNY 19520.00 |
|
| TP316627 | Recombinant protein of human pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325204 | Purified recombinant protein of Homo sapiens pleckstrin homology domain containing, family B (evectins) member 1 (PLEKHB1), transcript variant 4, 20 µg |
CNY 2900.00 |
