CBX1 (NM_001127228) Human Mass Spec Standard
CAT#: PH325198
CBX1 MS Standard C13 and N15-labeled recombinant protein (NP_001120700)
View other "CBX1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | CBX1 MS Standard C13 and N15-labeled recombinant protein (NP_001120700) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225198 |
| Predicted MW | 21.4 kDa |
| Protein Sequence |
>RC225198 protein sequence
Red=Cloning site Green=Tags(s) MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQS QKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKN SDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001120700 |
| RefSeq Size | 2253 |
| RefSeq ORF | 555 |
| Synonyms | CBX; HP1-BETA; HP1Hs-beta; HP1Hsbeta; M31; MOD1; p25beta |
| Locus ID | 10951 |
| Cytogenetics | 17q21.32 |
| Summary | This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402034 | CBX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC426727 | CBX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402034 | Transient overexpression lysate of chromobox homolog 1 (HP1 beta homolog Drosophila ) (CBX1), transcript variant 1 |
CNY 3080.00 |
|
| LY426727 | Transient overexpression lysate of chromobox homolog 1 (HP1 beta homolog Drosophila ) (CBX1), transcript variant 2 |
CNY 3080.00 |
|
| PH305672 | CBX1 MS Standard C13 and N15-labeled recombinant protein (NP_006798) |
CNY 19520.00 |
|
| TP305672 | Recombinant protein of human chromobox homolog 1 (HP1 beta homolog Drosophila ) (CBX1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP325198 | Recombinant protein of human chromobox homolog 1 (HP1 beta homolog Drosophila ) (CBX1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP710371 | Purified recombinant protein of human chromobox homolog 1 (CBX1), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4020.00 |
