TOMM6 (NM_001134493) Human Mass Spec Standard
CAT#: PH324993
TOMM6 MS Standard C13 and N15-labeled recombinant protein (NP_001127965)
View other "TOMM6" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | TOMM6 MS Standard C13 and N15-labeled recombinant protein (NP_001127965) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224993 |
| Predicted MW | 7.8 kDa |
| Protein Sequence |
>RC224993 representing NM_001134493
Red=Cloning site Green=Tags(s) MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAP QPGV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001127965 |
| RefSeq ORF | 222 |
| Synonyms | OBTP; TOM6 |
| Locus ID | 100188893 |
| Cytogenetics | 6p21.1 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC427460 | TOMM6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY427460 | Transient overexpression lysate of translocase of outer mitochondrial membrane 6 homolog (yeast) (TOMM6), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| TP324993 | Recombinant protein of human translocase of outer mitochondrial membrane 6 homolog (yeast) (TOMM6), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
