UBE2S (NM_014501) Human Mass Spec Standard
CAT#: PH324851
UBE2S MS Standard C13 and N15-labeled recombinant protein (NP_055316)
View other "UBE2S" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | UBE2S MS Standard C13 and N15-labeled recombinant protein (NP_055316) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224851 |
| Predicted MW | 23.7 kDa |
| Protein Sequence |
>RC224851 representing NM_014501
Red=Cloning site Green=Tags(s) MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDF PASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLEN YEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAK KKTDKKRALRRL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055316 |
| RefSeq Size | 890 |
| RefSeq ORF | 666 |
| Synonyms | E2-EPF; E2EPF; EPF5 |
| Locus ID | 27338 |
| Cytogenetics | 19q13.42 |
| Summary | This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | Ubiquitin mediated proteolysis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402342 | UBE2S HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402342 | Transient overexpression lysate of ubiquitin-conjugating enzyme E2S (UBE2S) |
CNY 3080.00 |
|
| TP324851 | Recombinant protein of human ubiquitin-conjugating enzyme E2S (UBE2S), 20 µg |
CNY 2900.00 |
|
| TP720259 | Recombinant protein of human ubiquitin-conjugating enzyme E2S (UBE2S) |
CNY 1800.00 |
