CRYGA (NM_014617) Human Mass Spec Standard
CAT#: PH324787
CRYGA MS Standard C13 and N15-labeled recombinant protein (NP_055432)
View other "CRYGA" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CRYGA MS Standard C13 and N15-labeled recombinant protein (NP_055432) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224787 |
Predicted MW | 20.7 kDa |
Protein Sequence |
>RC224787 representing NM_014617
Red=Cloning site Green=Tags(s) MGKITFYEDRDFQGRCYNCISDCPNLRVYFSRCNSIRVDSGCWMLYERPNYQGHQYFLRRGKYPDYQHWM GLSDSVQSCRIIPHTSSHKLRLYERDDYRGLMSELTDDCACVPELFRLPEIYSLHVLEGCWVLYEMPNYR GRQYLLRPGDYRRYHDWGGADAKVGSLRRVTDLY myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055432 |
RefSeq Size | 697 |
RefSeq ORF | 522 |
Synonyms | CRY-g-A; CRYG1; CRYG5 |
Locus ID | 1418 |
Cytogenetics | 2q33.3 |
Summary | Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415169 | CRYGA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415169 | Transient overexpression lysate of crystallin, gamma A (CRYGA) |
CNY 3080.00 |
|
TP324787 | Recombinant protein of human crystallin, gamma A (CRYGA), 20 µg |
CNY 2900.00 |