IL36 gamma (IL36G) (NM_019618) Human Mass Spec Standard
CAT#: PH324784
IL1F9 MS Standard C13 and N15-labeled recombinant protein (NP_062564)
View other "IL36 gamma" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | IL1F9 MS Standard C13 and N15-labeled recombinant protein (NP_062564) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224784 |
| Predicted MW | 18.7 kDa |
| Protein Sequence |
>RC224784 protein sequence
Red=Cloning site Green=Tags(s) MRGTPGDADGGGRAVYQSMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQG RGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFI ASSKRDQPIILTSELGKSYNTAFELNIND myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_062564 |
| RefSeq Size | 1212 |
| RefSeq ORF | 507 |
| Synonyms | IL-1F9; IL-1H1; IL-1RP2; IL1E; IL1F9; IL1H1; IL1RP2 |
| Locus ID | 56300 |
| Cytogenetics | 2q14.1 |
| Summary | The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, May 2019] |
| Protein Families | Druggable Genome, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412705 | IL36G HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412705 | Transient overexpression lysate of interleukin 1 family, member 9 (IL1F9) |
CNY 3080.00 |
|
| TP324784 | Recombinant protein of human interleukin 1 family, member 9 (IL1F9), 20 µg |
CNY 2900.00 |
其它IL36 gamma产品
