ROR1 (NM_001083592) Human Mass Spec Standard
CAT＃: PH324765
ROR1 MS Standard C13 and N15-labeled recombinant protein (NP_001077061)
View other "ROR1" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
CNY 1999.00
CNY 2700.00
CNY 4840.00
Specifications
| Product Data | |
| Description | ROR1 MS Standard C13 and N15-labeled recombinant protein (NP_001077061) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224765 |
| Predicted MW | 43.6 kDa |
| Protein Sequence |
>RC224765 representing NM_001083592
Red=Cloning site Green=Tags(s) MHRPRRRGTRPPLLALLAALLLAARGAAAQETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTS LGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVV SSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIG TSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLP NCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTAL RFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACGK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001077061 |
| RefSeq Size | 2303 |
| RefSeq ORF | 1179 |
| Synonyms | dJ537F10.1; NTRKR1 |
| Locus ID | 4919 |
| Cytogenetics | 1p31.3 |
| Summary | This gene encodes a receptor tyrosine kinase-like orphan receptor that modulates neurite growth in the central nervous system. The encoded protein is a glycosylated type I membrane protein that belongs to the ROR subfamily of cell surface receptors. It is a pseudokinase that lacks catalytic activity and may interact with the non-canonical Wnt signalling pathway. This gene is highly expressed during early embryonic development but expressed at very low levels in adult tissues. Increased expression of this gene is associated with B-cell chronic lymphocytic leukaemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jun 2012] |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401558 | ROR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC421225 | ROR1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401558 | Transient overexpression lysate of receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1 |
CNY 4840.00 |
|
| LY421225 | Transient overexpression lysate of receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2 |
CNY 3080.00 |
|
| PH314967 | ROR1 MS Standard C13 and N15-labeled recombinant protein (NP_005003) |
CNY 19520.00 |
|
| TP314967 | Recombinant protein of human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP324765 | Recombinant protein of human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP700158 | Purified recombinant protein of Homo sapiens receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1, residue 30-406 aa, expressed in HEK293 cells. |
CNY 6650.00 |
|
| TP700159 | Purified recombinant protein of Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells |
CNY 6650.00 |
|
| TP700184 | Purified recombinant protein of Homo sapiens receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1, residue 30-406 aa, expressed in HEK293 cells, with Fc tag |
CNY 6650.00 |
|
| TP762391 | Purified recombinant protein of Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 1, Gln30-Tyr406, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |
Purified recombinant protein of Human receptor tyrosine kinase-like orphan receptor 1 (ROR1), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells
