POLR2J2 (NM_032959) Human Mass Spec Standard
CAT#: PH324755
POLR2J2 MS Standard C13 and N15-labeled recombinant protein (NP_116581)
View other "POLR2J2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | POLR2J2 MS Standard C13 and N15-labeled recombinant protein (NP_116581) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224755 |
| Predicted MW | 12.9 kDa |
| Protein Sequence |
>RC224755 representing NM_032959
Red=Cloning site Green=Tags(s) MNAPPAFESFLLFEGEKITINKDTKVPNACLFTMNKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKI IIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_116581 |
| RefSeq Size | 1727 |
| RefSeq ORF | 345 |
| Synonyms | HRPB11B; POLR2J3; RPB11b1; RPB11b2 |
| Locus ID | 246721 |
| Cytogenetics | 7q22.1 |
| Summary | This gene is a member of the RNA polymerase II subunit 11 gene family, which includes three genes in a cluster on chromosome 7q22.1 and a pseudogene on chromosome 7p13. The founding member of this family, DNA directed RNA polymerase II polypeptide J, has been shown to encode a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This locus produces multiple, alternatively spliced transcripts that potentially express isoforms with distinct C-termini compared to DNA directed RNA polymerase II polypeptide J. Most or all variants are spliced to include additional non-coding exons at the 3' end which makes them candidates for nonsense-mediated decay (NMD). Consequently, it is not known if this locus expresses a protein or proteins in vivo. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
| Protein Pathways | Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409843 | POLR2J2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409843 | Transient overexpression lysate of polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2) |
CNY 3080.00 |
|
| TP324755 | Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2), 20 µg |
CNY 2900.00 |
|
| TP760696 | Purified recombinant protein of Human polymerase (RNA) II (DNA directed) polypeptide J2 (POLR2J2), with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
其它POLR2J2产品
