ERMAP (NM_018538) Human Mass Spec Standard
CAT#: PH324743
ERMAP MS Standard C13 and N15-labeled recombinant protein (NP_061008)
View other "ERMAP" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | ERMAP MS Standard C13 and N15-labeled recombinant protein (NP_061008) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224743 |
| Predicted MW | 52.6 kDa |
| Protein Sequence |
>RC224743 protein sequence
Red=Cloning site Green=Tags(s) MEMASSAGSWLSGCLIPLVFLRLSVHVSGHAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPF PQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVI LQVAAPSVGSLSPSAVALAVILPVLVLLIMVCLCLIWKQRRAKEKLLYEHVTEVDNLLSDHAKEKGKLHK AVKKLRSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDRRQPVPDNPQRFDFVV SILGSEYFTTGCHYWEVYVGDKTKWILGVCSESVSRKGKVTASPANGHWLLRQSRGNEYEALTSPQTSFR LKEPPRCVGIFLDYEAGVISFYNVTNKSHIFTFTHNFSGPLRPFFEPCLHDGGKNTAPLVICSELHKSEE SIVPRPEGKGHANGDVSLKVNSSLLPPKAPELKDIILSLPPDLGPALQELKAPSF myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_061008 |
| RefSeq Size | 3381 |
| RefSeq ORF | 1425 |
| Synonyms | BTN5; PRO2801; RD; SC |
| Locus ID | 114625 |
| Cytogenetics | 1p34.2 |
| Summary | The protein encoded by this gene is a cell surface transmembrane protein that may act as an erythroid cell receptor, possibly as a mediator of cell adhesion. Polymorphisms in this gene are responsible for the Scianna/Radin blood group system. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413005 | ERMAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422752 | ERMAP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY413005 | Transient overexpression lysate of erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2 |
CNY 3080.00 |
|
| LY422752 | Transient overexpression lysate of erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 1 |
CNY 4840.00 |
|
| PH315022 | ERMAP MS Standard C13 and N15-labeled recombinant protein (NP_001017922) |
CNY 19520.00 |
|
| TP315022 | Recombinant protein of human erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP324743 | Recombinant protein of human erythroblast membrane-associated protein (Scianna blood group) (ERMAP), transcript variant 2, 20 µg |
CNY 2900.00 |
